.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vg5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of RSGI RUH-014, a UBA domain from Arabidopsis thaliana cDNA. To be Published
    Site RSGI
    PDB Id 1vg5 Target Id atr001002820.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12234, Molecular Weight 6322.80 Da.
    Residues 60 Isoelectric Point 4.29
    Sequence srqapianaavlpqsqgrvaaseeqiqklvamgfdrtqvevalaaadddltvaveilmsq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vg5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch