The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for template-independent RNA polymerization. Nature 430 700-704 2004
    Site RSGI
    PDB Id 1vfg Target Id ar_001000505.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12174, Molecular Weight 45639.40 Da.
    Residues 390 Isoelectric Point 9.37
    Sequence mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpefgtahlkig klklefatarretyprpgaypkvepaslkedlirrdftinamaisvnledygtlidyfgglrdlkdkvi rvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavnlgllkeaprgrlineiklalredrfle ilelyrkyrvleeiiegfqwnekvlqklyalrkvvdwhalefseeridygwlyllilisnldyergkhf leemsapswvretykfmkfklgslkeelkkakenyevyrllkplhtsvllllmleeelkekiklylekl rkvklpkekieelkkqglkgkelgerieelkreimnkiklaaale
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.2865
    Matthews' coefficent 4.10 Rfactor 0.2297
    Waters 79 Solvent Content 70.00

    Ligand Information


    Google Scholar output for 1vfg

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch