.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vek

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of RSGI RUH-011, a UBA Domain from Arabidopsis cDNA. To be Published
    Site RSGI
    PDB Id 1vek Target Id atr001010759.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12254, Molecular Weight 7633.09 Da.
    Residues 71 Isoelectric Point 3.78
    Sequence geellpdgvpeevmesaqpvaneeivaqlvsmgfsqlhcqkaaintsnagveeamnwllshmddpdida pi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vek

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch