.
The Open Protein Structure Annotation Network
PDB Keyword
.

1veh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-018, a NifU-like domain of hirip5 protein from mouse cDNA. To be published
    Site RSGI
    PDB Id 1veh Target Id mmt007000028.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13467, Molecular Weight 8789.50 Da.
    Residues 79 Isoelectric Point 4.25
    Sequence seeddevvamikelldtrirptvqedggdviyrgfedgivrlklqgsctscpssiitlksgiqnmlqfy ipevegveqv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1veh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch