.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vee

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the rhodanese homology domain At4g01050(175-295) from Arabidopsis thaliana. Protein Sci. 14 224-230 2005
    Site RSGI
    PDB Id 1vee Target Id atr001001566.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12232, Molecular Weight 13191.24 Da.
    Residues 121 Isoelectric Point 9.07
    Sequence saknaytklgtddnaqlldiratadfrqvgspnikglgkkavstvyngedkpgflkklslkfkdpentt lyildkfdgnselvaelvalngfksayaikdgaegprgwlnsslpwiepkkt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vee

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch