The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th. HB8 Threonine deaminase. To be Published
    Site RSGI
    PDB Id 1ve5 Target Id ttk003000051.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14207, Molecular Weight 32775.03 Da.
    Residues 311 Isoelectric Point 9.32
    Sequence mpslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskalalenpkgll avssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvtaknreevaralqeetgya lihpfddplviagqgtaglellaqagrmgvfpgavlapvggggllaglatavkalspttlvlgvepeaa ddakrsleagrilrleapprtradgvrtlslgertfpilrervdgiltvseealleaerllftrtkqvv eptgalplaavlehgarlpqtlalllsggnrdfsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.245
    Matthews' coefficent 2.46 Rfactor 0.202
    Waters 256 Solvent Content 49.97

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 4
    Metals CA (CALCIUM) x 4


    Google Scholar output for 1ve5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch