.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ve4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ATP-phosphoribosyltransferase(HisG). To be Published
    Site RSGI
    PDB Id 1ve4 Target Id ttk003000056.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14209, Molecular Weight 22379.89 Da.
    Residues 206 Isoelectric Point 9.51
    Sequence mrrfaltvalpkgrmfreayevlkragldlpevegertllhgkeggvallelrnkdvpiyvdlgiaeig vvgkdvlldsgrdlfepvdlgfgacrlslirrpgdtgpirrvatkypnftarllkergwaadvvelsgn ielaavtgladavvdvvqtgatlraaglvevevlahstarlvvnrqalklkravlkpliqrlrelsgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.247
    Matthews' coefficent 2.23 Rfactor 0.23
    Waters 242 Solvent Content 44.78

    Ligand Information
    Ligands SO4 (SULFATE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1ve4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch