The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uroporphyrin-III-C-Methyltrans from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 1ve2 Target Id ttk003000205.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14271, Molecular Weight 24517.55 Da.
    Residues 235 Isoelectric Point 9.51
    Sequence mrgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvgkegyggktpqeaita rlialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavgalsalglplthrglarsf avatghdpalplpradtlvllmplhtlgglkerllerfppetplallarvgwpgeavrlgrvedlpglg eglpspallvvgkvvglygellpkdhgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.241
    Matthews' coefficent 2.24 Rfactor 0.207
    Waters 441 Solvent Content 45.07

    Ligand Information


    Google Scholar output for 1ve2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch