.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vdh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-based functional identification of a novel heme-binding protein from Thermus thermophilus HB8. J.STRUCT.FUNCT.GENOM. 6 21-32 2005
    Site RSGI
    PDB Id 1vdh Target Id ttk003001485.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14733, Molecular Weight 28904.39 Da.
    Residues 249 Isoelectric Point 5.78
    Sequence merhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsygiyqvvg hkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpldpespyvkprltprvpk sgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqgkvmqvisgaqglddwewgvdlfsedp vqfkkivyemrfdevsarygefgpffvgkyldeealraflgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.00 Rfree 0.218
    Matthews' coefficent 2.79 Rfactor 0.188
    Waters 1018 Solvent Content 55.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vdh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch