.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vd6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glycerophosphoryl Diester Phosphodiesterase complexed with Glycerol. To be Published
    Site RSGI
    PDB Id 1vd6 Target Id ttk003000487.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14380, Molecular Weight 24402.79 Da.
    Residues 224 Isoelectric Point 5.44
    Sequence mtafrqrplrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfqvdy adlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvwvssfdplallal rkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrglfvvawtvneegearrllalg ldgligdrpevllplgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.233
    Matthews' coefficent 2.05 Rfactor 0.217
    Waters 318 Solvent Content 39.65

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1vd6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch