.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vd0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of the monomeric form of the bacteriophage lambda capsid stabilizing protein gpD. J.Biomol.Nmr 31 351-356 2005
    Site RSGI
    PDB Id 1vd0 Target Id my_001000120.1
    Molecular Characteristics
    Source Bacteriophage t7
    Alias Ids TPS13746, Molecular Weight 11440.07 Da.
    Residues 109 Isoelectric Point 5.52
    Sequence tsketfthyqpqgnsdpahtatapgglsakapamtplmldtssrklvawdgttdgaavgilavaadqts ttltfyksgtfryedvlwpeaasdetkkrtafagtaisiv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vd0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch