.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vct

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 1vct Target Id pho001000236.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13799, Molecular Weight 22984.38 Da.
    Residues 205 Isoelectric Point 4.79
    Sequence meeveefkyepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvlaa rnvkeaeqvitilqianaiedisnaagdlakmvlegvelhpviketilegeeiigkiqvypesvivgkt lgeldlatntgvwiiavrrgkrwifgpnenfkiragdvligrgtrtsidhlkeiargairvignera
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.248
    Matthews' coefficent 2.67 Rfactor 0.211
    Waters 182 Solvent Content 53.90

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals NA (SODIUM) x 2;CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 1vct

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch