.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vcs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of RSGI RUH-009, an N-Terminal Domain of Vti1a [Mus musculus]. To be Published
    Site RSGI
    PDB Id 1vcs Target Id mmt007006799.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13489, Molecular Weight 10458.43 Da.
    Residues 89 Isoelectric Point 5.59
    Sequence egyeqdfavltaeitskiarvprlppdekkqmvanvekqleearelleqmdlevreippqsrgmysnrm rsykqemgkletdfkrsria
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vcs

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch