The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of IPP isomerase at I422. To be Published
    Site RSGI
    PDB Id 1vcf Target Id ttk003001255.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14668, Molecular Weight 36016.80 Da.
    Residues 332 Isoelectric Point 6.58
    Sequence mnirerkrkhleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamtgg eengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddll rlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalrdlpla avdvagaggtswarveewvrfgevrhpelceigiptarailevrevlphlplvasggvytgtdgakala lgadllavarpllrpalegaervaawigdyleelrtalfaigarnpkeargrverv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.26
    Matthews' coefficent 3.46 Rfactor 0.242
    Waters Solvent Content 64.18

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals CD (CADMIUM) x 1


    Google Scholar output for 1vcf

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch