.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vc9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Nudix Protein Ndx1 from Thermus thermophilus HB8 in binary complex with diadenosine hexaphosphate. To be Published
    Site RSGI
    PDB Id 1vc9 Target Id ttk003001331.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14688, Molecular Weight 14169.58 Da.
    Residues 126 Isoelectric Point 4.84
    Sequence melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllplyptryvnp kgverevhwflmrgegaprleegmtgagwfspeearallafpedlgllevalerlpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.252
    Matthews' coefficent 2.46 Rfactor 0.216
    Waters 119 Solvent Content 49.57

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1vc9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch