.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vc8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Nudix Protein Ndx1 from Thermus thermophilus HB8 in binary complex with diadenosine hexaphosphate. To be Published
    Site RSGI
    PDB Id 1vc8 Target Id ttk003001331.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14687, Molecular Weight 14169.58 Da.
    Residues 126 Isoelectric Point 4.84
    Sequence melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllplyptryvnp kgverevhwflmrgegaprleegmtgagwfspeearallafpedlgllevalerlpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.225
    Matthews' coefficent 2.82 Rfactor 0.195
    Waters 237 Solvent Content 56.46

    Ligand Information
    Ligands 5FA (ADENOSINE-5'-PENTAPHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1vc8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch