.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vbn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of nonnatural amino acid recognition by an engineered aminoacyl-tRNA synthetase for genetic code expansion. Proc.Natl.Acad.Sci.USA 102 1366-1371 2005
    Site RSGI
    PDB Id 1vbn Target Id eco001001308.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12265, Molecular Weight 47524.49 Da.
    Residues 424 Isoelectric Point 5.59
    Sequence massnlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkrfqqaghkpv alvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensaiaannydwfgnmnvltf lrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgydfaclnkqygvvlqiggsdqwgnits gidltrrlhqnqvfgltvplitkadgtkfgkteggavwldpkktspykfyqfwintadadvyrflkfft fmsieeinaleeedknsgkapraqyvlaeqvtrlvhgeeglqaakriteclfsgslsalseadfeqlaq dgvpmvemekgadlmqalvdselqpsrgqarktiasnaitingekqsdpeyffkeedrlfgrftllrrg kknyclicwk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.283
    Matthews' coefficent 51.21 Rfactor 0.217
    Waters 115 Solvent Content 2.54

    Ligand Information
    Ligands YSA (5'-O-[N-(L-TYROSYL)SULFAMOYL]ADENOSINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1vbn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch