.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vbk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Purification, crystallization and preliminary crystallographic analysis of the putative thiamine-biosynthesis protein PH1313 from Pyrococcus horikoshii OT3. Acta Crystallogr.,Sect.F 63 56-58 2007
    Site RSGI
    PDB Id 1vbk Target Id pho001001313.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13987, Molecular Weight 35148.42 Da.
    Residues 307 Isoelectric Point 9.33
    Sequence mnvvivrygeigtksrqtrswfekilmnnirealvteevpykeifsrhgriivktnspkeaanvlvrvf givsispameveaslekinrtallmfrkkakevgkerpkfrvtarritkefpldsleiqakvgeyilnn encevdlknydieigieimqgkayiytekikgwgglpigtegrmigilhdelsalaiflmmkrgvevip vyigkddknlekvrslwnllkrysygskgflvvaesfdrvlklirdfgvkgvikglrpndlnsevseit edfkmfpvpvyyplialpeeyiksvkerlgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.222
    Matthews' coefficent 2.33 Rfactor 0.199
    Waters 637 Solvent Content 46.87

    Ligand Information
    Ligands MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 4
    Metals

    Jmol

     
    Google Scholar output for 1vbk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch