.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vbg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of pyruvate phosphate dikinase from maize revealed an alternative conformation in the swiveling-domain motion. Biochemistry 44 1136-1144 2005
    Site RSGI
    PDB Id 1vbg Target Id my_001000036.1
    Molecular Characteristics
    Source Zea mays
    Alias Ids TPS13711, Molecular Weight 95187.90 Da.
    Residues 876 Isoelectric Point 5.27
    Sequence ttkkrvfhfgkgksegnktmkellggkganlaemasiglsvppgftvsteacqqyqdagcalpaglwae ivdglqwveeymgatlgdpqrplllsvrsgaavsmpgmmdtvlnlglndevaaglaaksgerfaydsfr rfldmfgnvvmdiprslfeeklehmkeskglkndtdltasdlkelvgqykevylsakgepfpsdpkkql elavlavfnswesprakkyrsinqitglrgtavnvqcmvfgnmgntsgtgvlftrnpntgekklygefl vnaqgedvvagirtpedldamknlmpqaydelvencnileshykemqdieftvqenrlwmlqcrtgkrt gksavkiavdmvneglveprsaikmvepghldqllhpqfenpsaykdqviatglpaspgaavgqvvfta edaeawhsqgkaailvraetspedvggmhaavgilterggmtshaavvargwgkccvsgcsgirvndae klvtigghvlregewlslngstgevilgkqplsppalsgdlgtfmawvddvrklkvlanadtpddalta rnngaqgiglcrtehmffasderikavrqmimaptlelrqqaldrllpyqrsdfegiframdglpvtir lldpplheflpegniedivselcaetganqedalarieklsevnpmlgfrgcrlgisypeltemqarai feaaiamtnqgvqvfpeimvplvgtpqelghqvtlirqvaekvfanvgktigykvgtmieipraalvad eiaeqaeffsfgtndltqmtfgysrddvgkfipvylaqgilqhdpfevldqrgvgelvkfatergrkar pnlkvgicgehggepssvaffakagldyvscspfrvpiarlaaaqvlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.237
    Matthews' coefficent 3.04 Rfactor 0.209
    Waters 248 Solvent Content 59.19

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1vbg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch