.
The Open Protein Structure Annotation Network
PDB Keyword
.

1va0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a closed-form uroporphyrinogen-III C-methyltransferase from Thermus thermophilus. Acta Crystallogr.,Sect.D 61 913-919 2005
    Site RSGI
    PDB Id 1va0 Target Id ttk003000228.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14299, Molecular Weight 26232.28 Da.
    Residues 240 Isoelectric Point 8.86
    Sequence mgrvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesekqeeihrll lrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrglahgfaavsgv legggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfverastpkerrvharleevaeg kvevrppalwilgevvrvfaekeapvdalalgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.97 Rfree 0.227
    Matthews' coefficent 48.68 Rfactor 0.199
    Waters 244 Solvent Content 2.42

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 5
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 1va0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch