.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v9s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uracil phosphoribosyltransferase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v9s Target Id ttk003000130.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14240, Molecular Weight 22760.36 Da.
    Residues 208 Isoelectric Point 6.39
    Sequence mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiaparvkvlsgk klalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppdiaerraflldpmlatggs aslalsllkergatgvklmailaapegleriakdhpdtevvvaaiderlndhgyivpglgdagdriygtk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.273
    Matthews' coefficent 3.20 Rfactor 0.238
    Waters 369 Solvent Content 61.30

    Ligand Information
    Ligands SO4 (SULFATE) x 23
    Metals

    Jmol

     
    Google Scholar output for 1v9s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch