.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v9o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8. J.Struct.Biol. 149 99-110 2005
    Site RSGI
    PDB Id 1v9o Target Id ttk003001020.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14510, Molecular Weight 12881.29 Da.
    Residues 116 Isoelectric Point 5.77
    Sequence mklivaivrpeklnevlealfqaevrgltlsrvqghggetervetyrgttvkmelhekvrleigvsepf vkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.247
    Matthews' coefficent 1.97 Rfactor 0.212
    Waters 120 Solvent Content 37.42

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1v9o

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch