The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Malate Dehydrogenase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1v9n Target Id pho001001277.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13982, Molecular Weight 39749.18 Da.
    Residues 360 Isoelectric Point 8.65
    Sequence mfekgyvdenyirvpkdrlfsfivrvltklgvpeedakivadnlvmadlrgveshgvqrlkryvdgiis ggvnlhpkirviregpsyalidgdeglgqvvgyrsmklaikkakdtgigiviarnsnhygiagyyalma aeegmigismtnsrplvaptggierilgtnpialaaptkdkpflldmatsvvpigklevyrrkgkdipe gwainregnittkveevfnggallplggfgellgghkgyglslmvdilsgilsggtwskyvkntsekgs nvchffmvidiehfipleefkekisqmieeikssrkhpeferiwihgekgfltmetrlklgipiyrkvl eelneiakrvgvegl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.243
    Matthews' coefficent 2.52 Rfactor 0.208
    Waters 192 Solvent Content 50.86

    Ligand Information
    Ligands NDP (NADPH) x 1;GOL (GLYCEROL) x 1


    Google Scholar output for 1v9n

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch