The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Pyrococcus Horikoshii CutA1 complexed with Co2+. To be Published
    Site RSGI
    PDB Id 1v9b Target Id pho001000992.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13959, Molecular Weight 12347.57 Da.
    Residues 102 Isoelectric Point 4.91
    Sequence miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktredlweelkeri kelhpydvpaiiridvddvnedylkwlieetkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.229
    Matthews' coefficent 1.78 Rfactor 0.18
    Waters 612 Solvent Content 30.45

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals CO (COBALT) x 3


    Google Scholar output for 1v9b

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch