.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v96

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PIN-domain protein PH0500 from Pyrococcus horikoshii. Acta Crystallogr.,Sect.F 61 463-468 2005
    Site RSGI
    PDB Id 1v96 Target Id pho001000500.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13826, Molecular Weight 17189.33 Da.
    Residues 149 Isoelectric Point 5.10
    Sequence mplppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefeilkdiyni vpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkryepirrfgldtmpldkfik evelmvekeli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.228
    Matthews' coefficent 2.88 Rfactor 0.209
    Waters 365 Solvent Content 56.89

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 1v96

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch