The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the tryptophan synthase beta subunit from the hyperthermophile Pyrococcus furiosus. Investigation of stabilization factors. Eur.J.Biochem. 271 2624-2635 2004
    Site RSGI
    PDB Id 1v8z Target Id my_001000047.1
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS13732, Molecular Weight 42526.67 Da.
    Residues 388 Isoelectric Point 6.85
    Sequence mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrltekiggakiy lkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagallgmkvdiymgaedverqk mnvfrmkllganvipvnsgsrtlkdainealrdwvatfeythyligsvvgphpyptivrdfqsvigrea kaqileaegqlpdvivacvgggsnamgifypfvndkkvklvgveaggkglesgkhsaslnagqvgvfhg mlsyflqdeegqikpthsiapgldypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipale sahavayamklakemsrdeiiivnlsgrgdkdldivlkvsgnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.21 Rfree 0.263
    Matthews' coefficent 2.20 Rfactor 0.208
    Waters 251 Solvent Content 44.14

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 4
    Metals NA (SODIUM) x 3


    Google Scholar output for 1v8z

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch