The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SoxZ protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v8h Target Id ttk003000351.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14341, Molecular Weight 11873.94 Da.
    Residues 108 Isoelectric Point 8.89
    Sequence mpfrtiarlnpakpkageefrlqvvaqhpnepgtrrdaegklipakyinlvevyfegekvaearpgpst sanplyafkfkaekagtftiklkdtdgdtgeasvklelv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.20 Rfree 0.2127
    Matthews' coefficent 2.17 Rfactor 0.2115
    Waters 362 Solvent Content 42.98

    Ligand Information


    Google Scholar output for 1v8h

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch