.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v8g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of anthranilate phosphoribosyltransferase (TrpD) from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v8g Target Id ttk003000014.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14156, Molecular Weight 34248.85 Da.
    Residues 329 Isoelectric Point 5.69
    Sequence mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramreaarplrvh rrplldivgtggdgkglmxlstlaalvaaaggvavakhgxraassragsadllealgvdleappervge aieelgfgflfarvfhpamrhvapvraelgvrtvfxllgpltxpagadayvlgvfspewlapmaealer lgarglvvhgegadelvlgexrvvevgkgayaltpeevglkraplealkgggpeexaalarrllkgeek gpladavalaagagfyaagktpslkegvalarevlasgeayllleryvaflra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.255
    Matthews' coefficent 2.38 Rfactor 0.212
    Waters 543 Solvent Content 47.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1v8g

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch