.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v8f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Pantothenate Synthetase From Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v8f Target Id ttk003000263.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14312, Molecular Weight 30693.75 Da.
    Residues 276 Isoelectric Point 6.26
    Sequence mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpgedyhryprd lerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpghfqgvatvvarlfllvqpq rayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglalssrnvylspetrkkapvlyrallamre vagqggsvaealrageealravpefrkdylaivhpetllplsdwvagargivagrfpearlidnlevyp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.257
    Matthews' coefficent 2.09 Rfactor 0.205
    Waters 724 Solvent Content 40.80

    Ligand Information
    Ligands 144 (TRIS-HYDROXYMETHYL-METHYL-AMMONIUM) x 1;P6G (HEXAETHYLENE) x 1;GOL (GLYCEROL) x 8
    Metals CL (CHLORIDE) x 5

    Jmol

     
    Google Scholar output for 1v8f

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch