The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v8d Target Id ttk003001679.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14774, Molecular Weight 25110.93 Da.
    Residues 235 Isoelectric Point 10.06
    Sequence mrrgsgnperpslsrdglrvpppcpgkrgpghfsgyhggmegirraaqraaeeflqafpmapgslfvlg gstsevlgervgtrpsleaahavlegllppllergvhvavqacehlnralvveretarafgleevavfp hpkaggalataaflrfrdpvmveslkaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktr pklvggaravytreemlkkleeflpkpp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.16 Rfree 0.249
    Matthews' coefficent 2.27 Rfactor 0.189
    Waters 368 Solvent Content 45.72

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1v8d

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch