.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v85

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Sterile alpha motif (SAM) domain of mouse bifunctional apoptosis regulator. To be Published
    Site RSGI
    PDB Id 1v85 Target Id mmt007008235.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13507, Molecular Weight 9289.10 Da.
    Residues 78 Isoelectric Point 5.91
    Sequence ehgllvhkavdkwtteevvlwleqlgpwaslyrdrflservngrllltlteeefsrapytiensshrrv iltelervr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1v85

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch