The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conformational Changes in the alpha-Subunit Coupled to Binding of the beta(2)-Subunit of Tryptophan Synthase from Escherichia coli: Crystal Structure of the Tryptophan Synthase alpha-Subunit Alon. Biochemistry 44 1184-1192 2005
    Site RSGI
    PDB Id 1v7y Target Id my_001000019.2
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS13683, Molecular Weight 28722.48 Da.
    Residues 268 Isoelectric Point 5.31
    Sequence meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdpladgptiqnatl rafaagvtpaqcfemlalirqkhptipigllmyanlvfnkgidefyaqcekvgvdsvlvadvpveesap frqaalrhnvapificppnadddllrqiasygrgytyllsragvtgaenraalplnhlvaklkeynaap plqgfgisapdqvkaaidagaagaisgsaivkiieqhinepekmlaalkvfvqpmkaatrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.271
    Matthews' coefficent 2.22 Rfactor 0.218
    Waters 87 Solvent Content 44.65

    Ligand Information
    Ligands SO4 (SULFATE) x 2


    Google Scholar output for 1v7y

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch