The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Phosphoglycerate Kinase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v6s Target Id ttk003000467.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14375, Molecular Weight 41774.75 Da.
    Residues 390 Isoelectric Point 5.61
    Sequence mrtlldldpkgkrvlvrvdynvpvqdgkvqdetrileslptlrhllaggaslvllshlgrpkgpdpkys lapvgealrahlpearfapfppgseearreaealrpgevlllenvrfepgeekndpelsaryarlgeaf vldafgsahrahasvvgvarllpayagflmekevralsrllkdperpyavvlggakvsdkigviesllp ridrlliggamaftflkalggevgrslveedrldlakdllgraealgvrvylpedvvaaerieagvetr vfparaipvpymgldigpktreafaralegartvfwngpmgvfevppfdegtlavgqaiaalegaftvv gggdsvaavnrlglkerfghvstgggasleflekgtlpglevleg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.215
    Matthews' coefficent 2.70 Rfactor 0.201
    Waters 734 Solvent Content 54.05

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals NA (SODIUM) x 3


    Google Scholar output for 1v6s

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch