The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structures of actin depolymerizing factor homology domains. Protein Sci. 18 2384-2392 2009
    Site RSGI
    PDB Id 1v6f Target Id mmk001003312.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13437, Molecular Weight 16159.61 Da.
    Residues 138 Isoelectric Point 4.98
    Sequence seslvvcdvaedlveklrkfrfrkethnaaiimkidkderlvvldeelegvspdelkdelperqprfiv ysykyqhddgrvsyplcfifsspvgckpeqqmmyagsknklvqtaeltkvfeirntedlteewlreklg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1v6f

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch