.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v5x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Stabilization due to dimer formation of phosphoribosyl anthranilate isomerase from Thermus thermophilus HB8: X-ray Analysis and DSC experiments. J.Biochem.(Tokyo) 137 569-578 2005
    Site RSGI
    PDB Id 1v5x Target Id ttk003000015.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14158, Molecular Weight 21949.20 Da.
    Residues 203 Isoelectric Point 6.03
    Sequence mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfrdqppeevlr lmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqallldgkrpgsgeaypraw akpllatgrrvilaggiapenleevlalrpyaldlasgveeapgvksaeklralfarlaslrmeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.296
    Matthews' coefficent 2.92 Rfactor 0.262
    Waters 301 Solvent Content 57.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1v5x

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch