The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a component of glycine cleavage system: T-protein from Pyrococcus horikoshii OT3 at 1.5 A resolution. Proteins 58 769-773 2004
    Site RSGI
    PDB Id 1v5v Target Id pho001001146.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13975, Molecular Weight 46168.70 Da.
    Residues 401 Isoelectric Point 5.59
    Sequence miqmvkrvhifdwhkeharkieefagwempiwyssikeehlavrnavgifdvshmgeivfrgkdalkfl qyvttndiskppaisgtytlvlnergaikdetlvfnmgnneylmicdsdafeklyawftylkrtieqft kldleielktydiamfavqgpkardlakdlfgidinemwwfqarwveldgikmllsrsgytgengfevy iedanpyhpdeskrgepekalhvwerileegkkygikpcglgardtlrleagytlygnetkelqllstd idevtplqanlefaiywdkdfigkdallkqkergvgrklvhfkmidkgipregykvyangemigevtsg tlspllnvgigiafvkeeyakpgieieveirgqrkkavtvtppfydpkkyglfret
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.209
    Matthews' coefficent 2.47 Rfactor 0.197
    Waters 547 Solvent Content 49.88

    Ligand Information


    Google Scholar output for 1v5v

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch