.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v5t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 8430435I17Rik Protein. To be Published
    Site RSGI
    PDB Id 1v5t Target Id mmt007019603.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13576, Molecular Weight 8564.84 Da.
    Residues 77 Isoelectric Point 9.80
    Sequence lpiivkwggqeysvttlskddtvldlkqflktltgvlperqkllglkvkgkpaendvklgalklkpntk immmgtre
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1v5t

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch