The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of kinase associated domain 1 of mouse MAP/microtubule affinity-regulating kinase 3. To be Published
    Site RSGI
    PDB Id 1v5s Target Id mmt007019316.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13575, Molecular Weight 9310.34 Da.
    Residues 80 Isoelectric Point 8.58
    Sequence dmmreirkvldanncdyeqrerfllfcvhgdghaenlvqwemevcklprlslngvrfkrisgtsiafkn iaskianelkl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1v5s

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch