The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of DC1 Domain of PDI-like Hypothetical Protein from Arabidopsis thaliana. To be Published
    Site RSGI
    PDB Id 1v5n Target Id atr001005336.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12240, Molecular Weight 9124.68 Da.
    Residues 76 Isoelectric Point 4.78
    Sequence teerlkeieakydeiakdwpkkvkhvlheeheleltrvqvytcdkceeegtiwsyhcdecdfdlhakca lnedtke
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1v5n

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch