.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v5h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of human cytoglobin for ligand binding. J.Mol.Biol. 339 873-885 2004
    Site RSGI
    PDB Id 1v5h Target Id my_001000023.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13693, Molecular Weight 21684.79 Da.
    Residues 193 Isoelectric Point 6.42
    Sequence gshmekvpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqfkhm edplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevv aeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnattppatlpssgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.25
    Matthews' coefficent 2.69 Rfactor 0.248
    Waters 30 Solvent Content 54.00

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 1v5h

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch