.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v4p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of alanyl-tRNA synthetase editing-domain homolog (PH0574) from a hyperthermophile, Pyrococcus horikoshii OT3 at 1.45 A resolution. Proteins 62 1133-1137 2006
    Site RSGI
    PDB Id 1v4p Target Id pho001000574.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13833, Molecular Weight 18151.13 Da.
    Residues 157 Isoelectric Point 6.93
    Sequence mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireierlanekvken apikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkehtkttgeigpikirkvrfr kskglleihfellelenps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.45 Rfree 0.227
    Matthews' coefficent 2.09 Rfactor 0.206
    Waters 599 Solvent Content 40.73

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 1v4p

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch