.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v3t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of leukotriene B4 12-hydroxydehydrogenase/15-Oxo-prostaglandin 13-reductase catalytic mechanism and a possible Src homology 3 domain binding loop. J.Biol.Chem. 279 22615-22623 2004
    Site RSGI
    PDB Id 1v3t Target Id my_001000011.1
    Molecular Characteristics
    Source Cavia porcellus
    Alias Ids TPS13671, Molecular Weight 36188.15 Da.
    Residues 333 Isoelectric Point 8.47
    Sequence spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkegavmmg qqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklplslalgtigmpgltayfgll evcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsdekiaylkqigfdaafnyktvnsleeal kkaspdgydcyfdnvggeflntvlsqmkdfgkiaicgaisvynrmdqlppgpspesiiykqlriegfiv yrwqgdvrekalrdlmkwvlegkiqyhehvtkgfenmpaafiemlnganlgkavvta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2552
    Matthews' coefficent 2.10 Rfactor 0.1942
    Waters 814 Solvent Content 40.96

    Ligand Information
    Ligands NAP (NADP) x 2
    Metals

    Jmol

     
    Google Scholar output for 1v3t

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch