The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8. J.Struct.Biol. 149 99-110 2005
    Site RSGI
    PDB Id 1v3r Target Id ttk003001020.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14513, Molecular Weight 12881.29 Da.
    Residues 116 Isoelectric Point 5.77
    Sequence mklivaivrpeklnevlealfqaevrgltlsrvqghggetervetyrgttvkmelhekvrleigvsepf vkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.225
    Matthews' coefficent 1.98 Rfactor 0.19
    Waters 178 Solvent Content 37.75

    Ligand Information


    Google Scholar output for 1v3r

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch