The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SWIB/MDM2 domain of the hypothetical protein At5g14170 from Arabidopsis thaliana. To be Published
    Site RSGI
    PDB Id 1v31 Target Id atr001008326.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12247, Molecular Weight 9100.19 Da.
    Residues 80 Isoelectric Point 9.25
    Sequence vpekfklstalmdvlgievetrpriiaaiwhyvkarklqnpndpsffncdaalqkvfgeeklkftmvsq kishhlspppp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1v31

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch