.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v2z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C-terminal clock-oscillator domain of the cyanobacterial KaiA protein. NAT.STRUCT.MOL.BIOL. 11 623-631 2004
    Site RSGI
    PDB Id 1v2z Target Id my_001000038.1
    Molecular Characteristics
    Source Thermosynechococcus elongatus
    Alias Ids TPS13714, Molecular Weight 13166.48 Da.
    Residues 111 Isoelectric Point 5.70
    Sequence stafffrrmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleihvelmd tfskqlklegrsedilldyrltlidviahlcemyrrsiprev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.26413
    Matthews' coefficent 2.02 Rfactor 0.22521
    Waters 73 Solvent Content 38.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1v2z

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch