.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v2x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Deep Knot Structure for Construction of Active Site and Cofactor Binding Site of tRNA Modification Enzyme. STRUCTURE 12 593-602 2004
    Site RSGI
    PDB Id 1v2x Target Id ttk003000912.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14495, Molecular Weight 22083.22 Da.
    Residues 194 Isoelectric Point 9.29
    Sequence mrertearrrrieevlrrrqpdltvllenvhkphnlsailrtcdavgvleahavnptggvptfnetsgg shkwvylrvhpdlheafrflkergftvyatalredardfrevdytkptavlfgaekwgvseealaladg aikipmlgmvqslnvsvaaavilfeaqrqrlkaglydrprldpelyqkvladwlrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.277
    Matthews' coefficent 1.69 Rfactor 0.225
    Waters 190 Solvent Content 26.78

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;SAM (S-ADENOSYLMETHIONINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1v2x

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch