.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v2b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the PsbP protein of photosystem II from Nicotiana tabacum. Embo Rep. 5 362-367 2004
    Site RSGI
    PDB Id 1v2b Target Id my_001000037.1
    Molecular Characteristics
    Source Nicotiana tabacum
    Alias Ids TPS13713, Molecular Weight 19387.48 Da.
    Residues 177 Isoelectric Point 5.25
    Sequence gkpktdtdfqtyngdgfklqipskwnpnkeveypgqvlrfednfdatsnvivaitptdkksitdfgspe qflsqvdyllgrqaysgktdseggfesdavaianvletstaevggkqyyylsiltrtadgneggkhqlv tatvndgklyickaqagdkrwfkgakkfventatsfsla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.20697
    Matthews' coefficent 2.27 Rfactor 0.18639
    Waters 433 Solvent Content 45.30

    Ligand Information
    Ligands GLC (ALPHA-D-GLUCOSE) x 2;SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1v2b

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch