.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v1s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Thermus Thermophilus 2-Keto-3-Deoxygluconate Kinase: Evidence for Recognition of an Open Chain Substrate. J.Mol.Biol. 340 477 2004
    Site RSGI
    PDB Id 1v1s Target Id ttk003000503.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14396, Molecular Weight 33428.39 Da.
    Residues 309 Isoelectric Point 5.38
    Sequence mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgedelgamveerl raegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdpdylegvrflhlsgitpal spearafslwameeakrrgvrvsldvnyrqtlwspeeargfleralpgvdllflseeeaellfgrveea lralsapevvlkrgakgawafvdgrrvegsafaveavdpvgagdafaagylagavwglpveerlrlanl lgasvaasrgdhegapyredlevllkatqtfmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 3.2 Rfree 0.2778
    Matthews' coefficent Rfactor 0.2391
    Waters Solvent Content 46.2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1v1s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch