.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v19

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Thermus Thermophilus 2-Keto-3-Deoxygluconate Kinase: Evidence for Recognition of an Open Chain Substrate. J.Mol.Biol. 340 477 2004
    Site RSGI
    PDB Id 1v19 Target Id ttk003000503.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14395, Molecular Weight 33428.39 Da.
    Residues 309 Isoelectric Point 5.38
    Sequence mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgedelgamveerl raegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdpdylegvrflhlsgitpal spearafslwameeakrrgvrvsldvnyrqtlwspeeargfleralpgvdllflseeeaellfgrveea lralsapevvlkrgakgawafvdgrrvegsafaveavdpvgagdafaagylagavwglpveerlrlanl lgasvaasrgdhegapyredlevllkatqtfmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.3 Rfree 0.1984
    Matthews' coefficent Rfactor 0.1529
    Waters 109 Solvent Content 53.0

    Ligand Information
    Ligands DIO (1,4-DIETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1v19

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch