.
The Open Protein Structure Annotation Network
PDB Keyword
.

1usf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Styrene Monooxygenase Small Component from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 1usf Target Id ttk003000318.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14332, Molecular Weight 19713.47 Da.
    Residues 178 Isoelectric Point 6.75
    Sequence mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrfthglllkarr fsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayelellevhtfgdhdlfvgrv vavweeeglldekgrpkpglallyygkglygrpaeetfap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.3 Rfree 0.230
    Matthews' coefficent Rfactor 0.211
    Waters 344 Solvent Content

    Ligand Information
    Ligands FMN (FLAVIN) x 2;NAP (NADP) x 4;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1usf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch